Introduction | What goes in a Submission to a Health Authority? | Study Data Standardization Plan | SDTM and ADaM Data Packages | What is {xportr} validating in these Data Packages? | {xportr} in action | Using xportr_metadata() to reduce repetition | Going meta | Warnings and Errors | Setting up our metadata object | xportr_type() | xportr_length() | xportr_label() | xportr_order() | xportr_format() | xportr_write() | xportr() | Future Work
This package is considered a duplicate. The official version of this package is found at:https://atorus-research.r-universe.dev/xportr
Package: xportr 0.6.1
Eli Miller
xportr: Utilities to Output CDISC SDTM/ADaM XPT Files
Tools to build CDISC compliant data sets and check for CDISC compliance.
Authors:
xportr_0.6.1.tar.gz
xportr_0.6.1.zip(r-4.7-any)xportr_0.6.1.zip(r-4.6-any)
xportr_0.6.1.tar.gz(r-4.7-any)xportr_0.6.1.tar.gz(r-4.6-any)
xportr_0.6.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
xportr/json (API)
| # Install 'xportr' in R: |
| install.packages('xportr', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/atorus-research/xportr/issues
Pkgdown/docs site:https://atorus-research.github.io
Datasets:
- adsl_xportr - Analysis Dataset Subject Level
- dataset_spec - Example Dataset Specification
- var_spec - Example Dataset Variable Specification
Last updated from:ce36552439. Checks:6 OK. Indexed: no.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel | OK | 164 | ||
| source / vignettes | OK | 214 | ||
| linux-release | OK | 147 | ||
| windows-devel | OK | 117 | ||
| windows-release | OK | 138 | ||
| wasm-release | OK | 129 |
Exports:xportrxportr_df_labelxportr_formatxportr_labelxportr_lengthxportr_metadataxportr_optionsxportr_orderxportr_splitxportr_typexportr_writexpt_validate
Dependencies:backportsbitbit64checkmateclicliprcpp11crayondplyrforcatsgenericsgluehavenhmslifecyclemagrittrpillarpkgconfigprettyunitsprogresspurrrR6readrrlangtibbletidyselecttzdbutf8vctrsvroomwithr
Deep Dive into xportr
Last update: 2026-09-01
Started: 2023-06-21
Getting Started
Getting Started with xportr | Preparing your Specification Files | xportr_type() | xportr_length() | xportr_order() | xportr_format() | xportr_label() | xportr_write()
Last update: 2026-09-01
Started: 2022-06-21
You got options
Introduction | You've got options() or xportr_options() | Are we being too verbose? | Type coercion options | Putting it all together
Last update: 2026-09-01
Started: 2026-09-01
Standards in Different Regulatory Agencies
Motivation | File name - character | XPT | FDA | NMPA | PMDA | File name - length | Variable name | Variable length | Label character | Label length | Values character | Values length | Format | Type | File size
Last update: 2026-01-13
Started: 2024-03-29
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Analysis Dataset Subject Level | adsl_xportr |
| Example Dataset Specification | dataset_spec |
| Example Dataset Variable Specification | var_spec |
| Wrapper to apply all core xportr functions and write xpt | xportr |
| Assign Dataset Label | xportr_df_label |
| Assign SAS Format | xportr_format |
| Assign Variable Label | xportr_label |
| Assign SAS Length | xportr_length |
| Set variable specifications and domain | xportr_metadata |
| Get or set xportr options | xportr_options |
| Order variables of a dataset according to Spec | xportr_order |
| Deprecated - Split xpt file output | xportr_split |
| Coerce variable type | xportr_type |
| Write xpt v5 transport file | xportr_write |
| Validate Dataset Can be Written to xpt | xpt_validate |