Package: viraldomain 0.0.6
Juan Pablo Acuña González
viraldomain: Applicability Domain Methods of Viral Load and CD4 Lymphocytes
Provides methods for assessing the applicability domain of models that predict viral load and CD4 (Cluster of Differentiation 4) lymphocyte counts. These methods help determine the extent of extrapolation when making predictions.
Authors:
viraldomain_0.0.6.tar.gz
viraldomain_0.0.6.tar.gz(r-4.5-noble)viraldomain_0.0.6.tar.gz(r-4.4-noble)
viraldomain_0.0.6.tgz(r-4.4-emscripten)viraldomain_0.0.6.tgz(r-4.3-emscripten)
viraldomain.pdf |viraldomain.html✨
viraldomain/json (API)
NEWS
| # Install 'viraldomain' in R: |
| install.packages('viraldomain', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/juanv66x/viraldomain/issues
Last updated 5 days agofrom:09cb3eb2aa. Checks:OK: 2. Indexed: no.
| Target | Result | Date |
|---|---|---|
| Doc / Vignettes | OK | Oct 18 2024 |
| R-4.5-linux | OK | Oct 18 2024 |
Exports:knn_domain_scoremars_domain_scorenn_domain_scorenormalized_domain_plotrf_domain_scoresimple_domain_plot
Dependencies:applicableclasscliclockcodetoolscolorspacecpp11data.tablediagramdigestdplyrfansifarverfuturefuture.applygenericsggplot2globalsgluegowergtablehardhatipredisobandKernSmoothlabelinglatticelavalifecyclelistenvlubridatemagrittrMASSMatrixmgcvmodelenvmunsellnlmennetnumDerivparallellyparsnippillarpkgconfigprettyunitsprodlimprogressrproxyCpurrrR6RColorBrewerRcppRcppArmadillorecipesrlangrpartscalesshapeSQUAREMstringistringrsurvivaltibbletidyrtidyselecttimechangetimeDatetzdbutf8vctrsviridisLitewithrworkflows
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Calculate the K-Nearest Neighbor model domain applicability score | knn_domain_score |
| Calculate the MARS model domain applicability score | mars_domain_score |
| Calculate the Neural Network model domain applicability score | nn_domain_score |
| Create a Normalized Domain Plot | normalized_domain_plot |
| Calculate the Random Forest Model Domain Applicability Score | rf_domain_score |
| Seropositive Data for Applicability Domain Testing | sero |
| Create a Simple Domain Plot | simple_domain_plot |
| Predictive Modeling Data for Viral Load and CD4 Lymphocyte Counts | viral |
