Package: sazedR 2.0.2

Tiago Santos

sazedR: Parameter-Free Domain-Agnostic Season Length Detection in Time Series

Spectral and Average Autocorrelation Zero Distance Density ('sazed') is a method for estimating the season length of a seasonal time series. 'sazed' is aimed at practitioners, as it employs only domain-agnostic preprocessing and does not depend on parameter tuning or empirical constants. The computation of 'sazed' relies on the efficient autocorrelation computation methods suggested by Thibauld Nion (2012, URL: <https://etudes.tibonihoo.net/literate_musing/autocorrelations.html>) and by Bob Carpenter (2012, URL: <https://lingpipe-blog.com/2012/06/08/autocorrelation-fft-kiss-eigen/>).

Authors:Maximilian Toller [aut], Tiago Santos [aut, cre], Roman Kern [aut]

sazedR_2.0.2.tar.gz
sazedR_2.0.2.tar.gz(r-4.5-noble)sazedR_2.0.2.tar.gz(r-4.4-noble)
sazedR_2.0.2.tgz(r-4.4-emscripten)sazedR_2.0.2.tgz(r-4.3-emscripten)
sazedR.pdf |sazedR.html
sazedR/json (API)
NEWS

# Install 'sazedR' in R:
install.packages('sazedR', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/mtoller/autocorr_season_length_detection/issues

1.70 score 230 downloads 10 exports 21 dependencies

Last updated 4 years agofrom:6d710ca3fd. Checks:2 OK. Indexed: yes.

TargetResultLatest binary
Doc / VignettesOKJan 28 2025
R-4.5-linuxOKJan 28 2025

Exports:azeazedcomputeAcfpreprocessTsSSasazedsazed.majzezed

Dependencies:bspecclidplyrfansifftwtoolsgenericsgluelatticelifecyclemagrittrpillarpkgconfigpracmaR6rlangtibbletidyselectutf8vctrswithrzoo