Package: newdata 0.1.0
Joe Thorley
newdata: Generate New Data Frames for Prediction
Generates new data frames for predictive purposes. By default, all specified variables vary across their range while all other variables are held constant at the default reference value. Types, classes, factor levels and time zones are always preserved. The user can specify the length of each sequence, require that only observed values and combinations are used and add new variables. The result is intended to be passed to the prediction method of a fitted model object to visualize the effect of one or more variables while controlling for the others.
Authors:
newdata_0.1.0.tar.gz
newdata_0.1.0.zip(r-4.7-any)newdata_0.1.0.zip(r-4.6-any)
newdata_0.1.0.tar.gz(r-4.7-any)newdata_0.1.0.tar.gz(r-4.6-any)
newdata_0.1.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
newdata/json (API)
| # Install 'newdata' in R: |
| install.packages('newdata', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/poissonconsulting/newdata/issues
Pkgdown/docs site:https://poissonconsulting.github.io
- old_data - Example Data
Last updated from:9db79520b0. Checks:6 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel | OK | 121 | ||
| source / vignettes | OK | 176 | ||
| linux-release | OK | 116 | ||
| windows-devel | OK | 71 | ||
| windows-release | OK | 86 | ||
| wasm-release | OK | 94 |
Exports:new_datanew_seqnew_valuexcastxnew_dataxnew_seqxnew_valuexobs_only
Dependencies:chkclicpp11dplyrgenericsgluehmslifecyclemagrittrpillarpkgconfigpurrrR6rlangstringistringrtibbletidyrtidyselectutf8vctrswithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Generate New Data *[Superseded]* | new_data |
| Generate New Sequence | new_seq new_seq.character new_seq.Date new_seq.default new_seq.double new_seq.factor new_seq.hms new_seq.integer new_seq.logical new_seq.ordered new_seq.POSIXct |
| Generate New Reference Value | new_value |
| Example Data | old_data |
| Cast New Values for 'xnew_data()' | xcast |
| Generate New Data by Expansion | xnew_data |
| Generate New Sequence for 'xnew_data()' | xnew_seq |
| Generate New Reference Value for 'xnew_data()' | xnew_value |
| Generate Observed Combinations Only | xobs_only |