Package: evgam 1.0.1
Ben Youngman
evgam: Generalised Additive Extreme Value Models
Methods for fitting various extreme value distributions with parameters of generalised additive model (GAM) form are provided. For details of distributions see Coles, S.G. (2001) <doi:10.1007/978-1-4471-3675-0>, GAMs see Wood, S.N. (2017) <doi:10.1201/9781315370279>, and the fitting approach see Wood, S.N., Pya, N. & Safken, B. (2016) <doi:10.1080/01621459.2016.1180986>. Details of how evgam works and various examples are given in Youngman, B.D. (2022) <doi:10.18637/jss.v103.i03>.
Authors:
evgam_1.0.1.tar.gz
evgam_1.0.1.tar.gz(r-4.7-arm64)evgam_1.0.1.tar.gz(r-4.7-x86_64)evgam_1.0.1.tar.gz(r-4.6-arm64)evgam_1.0.1.tar.gz(r-4.6-x86_64)
evgam_1.0.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
card.svg |card.png
evgam/json (API)
NEWS
| # Install 'evgam' in R: |
| install.packages('evgam', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
- COelev - Colorado daily precipitation accumulations
- COprcp - Colorado daily precipitation accumulations
- COprcp_meta - Colorado daily precipitation accumulations
- FCtmax - Fort Collins, Colorado, US daily max. temperatures
- fremantle - Annual Maximum Sea Levels at Fremantle, Western Australia
This package does not link to any Github/Gitlab/R-forge repository. No issue tracker or development information is available.
Last updated from:9cd48e5b11. Checks:6 OK. Indexed: no.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-arm64 | OK | 196 | ||
| linux-devel-x86_64 | OK | 180 | ||
| source / vignettes | OK | 200 | ||
| linux-release-arm64 | OK | 205 | ||
| linux-release-x86_64 | OK | 182 | ||
| wasm-release | OK | 153 |
Exports:colplotdfbinddfrunmaxevgamextremalfevgamginv.evgampinvqevrunmaxseq_between
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Scatter plot, with variable-based point colours | colplot |
| Colorado daily precipitation accumulations | COelev COprcp COprcp_meta |
| Bind a list a data frames | dfbind |
| Fitting generalised additive extreme-value family models | evgam fevgam |
| Estimate extremal index using `intervals' method | extremal |
| Fort Collins, Colorado, US daily max. temperatures | FCtmax |
| Extract Model Fitted Values | fitted.evgam |
| Annual Maximum Sea Levels at Fremantle, Western Australia | fremantle |
| Log-likelihood, AIC and BIC from a fitted 'evgam' object | logLik.evgam |
| Moore-Penrose pseudo-inverse of a matrix | ginv.evgam pinv |
| Plot a fitted 'evgam' object | plot.evgam |
| Predictions from a fitted 'evgam' object | predict.evgam |
| Print a fitted 'evgam' object | print.evgam |
| Quantile estimation of a composite extreme value distribution | qev |
| Running maximum | dfrunmax runmax |
| More Sequence Generation | seq_between |
| Simulations from a fitted 'evgam' object | simulate.evgam |
| Summary method for a fitted 'evgam' object | print.summary.evgam summary.evgam |
