Package: evgam 1.0.0
evgam: Generalised Additive Extreme Value Models
Methods for fitting various extreme value distributions with parameters of generalised additive model (GAM) form are provided. For details of distributions see Coles, S.G. (2001) <doi:10.1007/978-1-4471-3675-0>, GAMs see Wood, S.N. (2017) <doi:10.1201/9781315370279>, and the fitting approach see Wood, S.N., Pya, N. & Safken, B. (2016) <doi:10.1080/01621459.2016.1180986>. Details of how evgam works and various examples are given in Youngman, B.D. (2022) <doi:10.18637/jss.v103.i03>.
Authors:
evgam_1.0.0.tar.gz
evgam_1.0.0.tar.gz(r-4.5-noble)evgam_1.0.0.tar.gz(r-4.4-noble)
evgam_1.0.0.tgz(r-4.4-emscripten)evgam_1.0.0.tgz(r-4.3-emscripten)
evgam.pdf |evgam.html✨
evgam/json (API)
NEWS
# Install 'evgam' in R: |
install.packages('evgam', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
- COelev - Colorado daily precipitation accumulations
- COprcp - Colorado daily precipitation accumulations
- COprcp_meta - Colorado daily precipitation accumulations
- FCtmax - Fort Collins, Colorado, US daily max. temperatures
- fremantle - Annual Maximum Sea Levels at Fremantle, Western Australia
This package does not link to any Github/Gitlab/R-forge repository. No issue tracker or development information is available.
Last updated 2 years agofrom:e2d6020708. Checks:OK: 1 NOTE: 1. Indexed: no.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Dec 04 2024 |
R-4.5-linux-x86_64 | NOTE | Dec 04 2024 |
Exports:colplotdfbinddfrunmaxevgamextremalfevgamginv.evgampinvqevrunmaxseq_between
Readme and manuals
Help Manual
Help page | Topics |
---|---|
Scatter plot, with variable-based point colours | colplot |
Colorado daily precipitation accumulations | COelev COprcp COprcp_meta |
Bind a list a data frames | dfbind |
Fitting generalised additive extreme-value family models | evgam fevgam |
Estimate extremal index using `intervals' method | extremal |
Fort Collins, Colorado, US daily max. temperatures | FCtmax |
Extract Model Fitted Values | fitted.evgam |
Annual Maximum Sea Levels at Fremantle, Western Australia | fremantle |
Log-likelihood, AIC and BIC from a fitted 'evgam' object | logLik.evgam |
Moore-Penrose pseudo-inverse of a matrix | ginv.evgam pinv |
Plot a fitted 'evgam' object | plot.evgam |
Predictions from a fitted 'evgam' object | predict.evgam |
Print a fitted 'evgam' object | print.evgam |
Quantile estimation of a composite extreme value distribution | qev |
Running maximum | dfrunmax runmax |
More Sequence Generation | seq_between |
Simulations from a fitted 'evgam' object | simulate.evgam |
Summary method for a fitted 'evgam' object | print.summary.evgam summary.evgam |