Package: BFpack 1.3.0
Joris Mulder
BFpack: Flexible Bayes Factor Testing of Scientific Expectations
Implementation of default Bayes factors for testing statistical hypotheses under various statistical models. The package is intended for applied quantitative researchers in the social and behavioral sciences, medical research, and related fields. The Bayes factor tests can be executed for statistical models such as univariate and multivariate normal linear models, correlation analysis, generalized linear models, special cases of linear mixed models, survival models, relational event models. Parameters that can be tested are location parameters (e.g., group means, regression coefficients), variances (e.g., group variances), and measures of association (e.g,. polychoric/polyserial/biserial/tetrachoric/product moments correlations), among others. The statistical underpinnings are described in Mulder and Xin (2019) <doi:10.1080/00273171.2021.1904809>, Mulder and Gelissen (2019) <doi:10.1080/02664763.2021.1992360>, Mulder (2016) <doi:10.1016/j.jmp.2014.09.004>, Mulder and Fox (2019) <doi:10.1214/18-BA1115>, Mulder and Fox (2013) <doi:10.1007/s11222-011-9295-3>, Boeing-Messing, van Assen, Hofman, Hoijtink, and Mulder (2017) <doi:10.1037/met0000116>, Hoijtink, Mulder, van Lissa, and Gu, (2018) <doi:10.31234/osf.io/v3shc>, Gu, Mulder, and Hoijtink, (2018) <doi:10.1111/bmsp.12110>, Hoijtink, Gu, and Mulder, (2018) <doi:10.1111/bmsp.12145>, and Hoijtink, Gu, Mulder, and Rosseel, (2018) <doi:10.1037/met0000187>. When using the packages, please refer to Mulder et al. (2021) <doi:10.18637/jss.v100.i18>.
Authors:
BFpack_1.3.0.tar.gz
BFpack_1.3.0.tar.gz(r-4.5-noble)BFpack_1.3.0.tar.gz(r-4.4-noble)
BFpack.pdf |BFpack.html✨
BFpack/json (API)
NEWS
# Install 'BFpack' in R: |
install.packages('BFpack', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/jomulder/bfpack/issues
- Fcor - Student t approximations of Fisher transformed correlations
- actors - Actors from a small hypothetical network
- attention - Multiple Sources of Attentional Dysfunction in Adults With Tourette's Syndrome
- fmri - FMRI data
- memory - Memory data on health and schizophrenic patients
- relevents - A sequence of innovation-related e-mail messages
- same_culture - Same culture event statistic
- same_location - Same location event statistic
- sivan - Wason task performance and morality
- therapeutic - Data come from an experimental study (Rosa, Rosa, Sarner, and Barrett, 1998) that were also used in Howell (2012, p.196). An experiment was conducted to investigate if Therapeutic Touch practitioners who were blindfolded can effectively identify which of their hands is below the experimenter¡¯s. Twenty-eight practitioners were involved and tested 10 times in the experiment. Researchers expected an average of 5 correct answers from each practitioner as it is the number by chance if they do not outperform others.
- timssICC - Trends in International Mathematics and Science Study (TIMSS) 2011-2015
- tvprices - Precision of the Anchor Influences the Amount of Adjustment
- wilson - Facial trustworthiness and criminal sentencing
Last updated 4 months agofrom:5d8c3dfdf9. Checks:OK: 2. Indexed: no.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Oct 12 2024 |
R-4.5-linux-x86_64 | OK | Oct 12 2024 |
Exports:bartlett_testBFcor_testmvt_test
Dependencies:bainBergmbootcachemclicodaDEoptimRergmevaluateextraDistrfansifastmapgluegslhighrknitrlatticelavaanlifecyclelme4lpSolveAPImagrittrMASSMatrixmatrixcalcMatrixModelsmcmcMCMCpackmemoisemgcvminqamnormtmvtnormnetworknlmenloptrnumDerivpbivnormpillarpkgconfigpracmapurrrQRMquadprogquantregrbibutilsRcppRcppEigenRdpackRglpkrlangrlerobustbasesandwichslamSparseMstatnet.commonstringistringrsurvivaltibbletimeDatetimeSeriestrustutf8vctrsxfunyamlzoo