Package: BFpack 1.3.0

Joris Mulder

BFpack: Flexible Bayes Factor Testing of Scientific Expectations

Implementation of default Bayes factors for testing statistical hypotheses under various statistical models. The package is intended for applied quantitative researchers in the social and behavioral sciences, medical research, and related fields. The Bayes factor tests can be executed for statistical models such as univariate and multivariate normal linear models, correlation analysis, generalized linear models, special cases of linear mixed models, survival models, relational event models. Parameters that can be tested are location parameters (e.g., group means, regression coefficients), variances (e.g., group variances), and measures of association (e.g,. polychoric/polyserial/biserial/tetrachoric/product moments correlations), among others. The statistical underpinnings are described in Mulder and Xin (2019) <doi:10.1080/00273171.2021.1904809>, Mulder and Gelissen (2019) <doi:10.1080/02664763.2021.1992360>, Mulder (2016) <doi:10.1016/j.jmp.2014.09.004>, Mulder and Fox (2019) <doi:10.1214/18-BA1115>, Mulder and Fox (2013) <doi:10.1007/s11222-011-9295-3>, Boeing-Messing, van Assen, Hofman, Hoijtink, and Mulder (2017) <doi:10.1037/met0000116>, Hoijtink, Mulder, van Lissa, and Gu, (2018) <doi:10.31234/osf.io/v3shc>, Gu, Mulder, and Hoijtink, (2018) <doi:10.1111/bmsp.12110>, Hoijtink, Gu, and Mulder, (2018) <doi:10.1111/bmsp.12145>, and Hoijtink, Gu, Mulder, and Rosseel, (2018) <doi:10.1037/met0000187>. When using the packages, please refer to Mulder et al. (2021) <doi:10.18637/jss.v100.i18>.

Authors:Joris Mulder [aut, cre], Caspar van Lissa [aut, ctb], Donald R. Williams [aut, ctb], Xin Gu [aut, ctb], Anton Olsson-Collentine [aut, ctb], Florian Boeing-Messing [aut, ctb], Jean-Paul Fox [aut, ctb], Janosch Menke [ctb], Robbie van Aert [ctb], Barry Brown [ctb], James Lovato [ctb], Kathy Russell [ctb], Lapack 3.8 [ctb], Jack Dongarra [ctb], Jim Bunch [ctb], Cleve Moler [ctb], Gilbert Stewart [ctb], John Burkandt [ctb], Ashwith Rego [ctb], Alexander Godunov [ctb], Alan Miller [ctb], Jean-Pierre Moreau [ctb], The R Core Team [cph]

BFpack_1.3.0.tar.gz
BFpack_1.3.0.tar.gz(r-4.5-noble)BFpack_1.3.0.tar.gz(r-4.4-noble)
BFpack_1.3.0.tgz(r-4.4-emscripten)
BFpack.pdf |BFpack.html✨
BFpack/json (API)
NEWS

# Install 'BFpack' in R:
install.packages('BFpack', repos = c('https://cran.r-universe.dev', 'https://cloud.r-project.org'))

Peer review:

Bug tracker:https://github.com/jomulder/bfpack/issues

Uses libs:
  • openblas– Optimized BLAS
  • fortran– Runtime library for GNU Fortran applications
Datasets:
  • Fcor - Student t approximations of Fisher transformed correlations
  • actors - Actors from a small hypothetical network
  • attention - Multiple Sources of Attentional Dysfunction in Adults With Tourette's Syndrome
  • fmri - FMRI data
  • memory - Memory data on health and schizophrenic patients
  • relevents - A sequence of innovation-related e-mail messages
  • same_culture - Same culture event statistic
  • same_location - Same location event statistic
  • sivan - Wason task performance and morality
  • therapeutic - Data come from an experimental study (Rosa, Rosa, Sarner, and Barrett, 1998) that were also used in Howell (2012, p.196). An experiment was conducted to investigate if Therapeutic Touch practitioners who were blindfolded can effectively identify which of their hands is below the experimenter¡¯s. Twenty-eight practitioners were involved and tested 10 times in the experiment. Researchers expected an average of 5 correct answers from each practitioner as it is the number by chance if they do not outperform others.
  • timssICC - Trends in International Mathematics and Science Study (TIMSS) 2011-2015
  • tvprices - Precision of the Anchor Influences the Amount of Adjustment
  • wilson - Facial trustworthiness and criminal sentencing

4.39 score 3 packages 54 scripts 976 downloads 4 exports 69 dependencies

Last updated 5 months agofrom:5d8c3dfdf9. Checks:OK: 2. Indexed: no.

TargetResultDate
Doc / VignettesOKNov 11 2024
R-4.5-linux-x86_64OKNov 11 2024

Exports:bartlett_testBFcor_testmvt_test

Dependencies:bainBergmbootcachemclicodaDEoptimRergmevaluateextraDistrfansifastmapgluegslhighrknitrlatticelavaanlifecyclelme4lpSolveAPImagrittrMASSMatrixmatrixcalcMatrixModelsmcmcMCMCpackmemoisemgcvminqamnormtmvtnormnetworknlmenloptrnumDerivpbivnormpillarpkgconfigpracmapurrrQRMquadprogquantregrbibutilsRcppRcppEigenRdpackRglpkrlangrlerobustbasesandwichslamSparseMstatnet.commonstringistringrsurvivaltibbletimeDatetimeSeriestrustutf8vctrsxfunyamlzoo

Introduction to BFpack

Mulder, J., Williams, D. R., Gu, X., Tomarken, A., Boeing-Messing, F., Olsson-Collentine, A., Meijerink, M., Menke, J., van Aert, R., Fox, J.-P., Hoijtink, H., Rosseel, Y., Wagenmakers, E.-J., and van Lissa, C.

Rendered fromvignette_BFpack.Rmdusingknitr::rmarkdownon Nov 11 2024.

Last update: 2024-06-20
Started: 2020-11-30

Readme and manuals

Help Manual

Help pageTopics
BFpack: Flexible Bayes factor testing of scientific expectationsBFpack-package BFpack
Actors from a small hypothetical networkactors
Multiple Sources of Attentional Dysfunction in Adults With Tourette's Syndromeattention
Bartlett Test of Homogeneity of Variancesbartlett_test bartlett_test.default
Bayes factors for Bayesian exploratory and confirmatory hypothesis testingBF BF.default BF.lm BF.t_test
Bayesian correlation analysiscor_test
Student t approximations of Fisher transformed correlationsFcor
fMRI datafmri
Memory data on health and schizophrenic patientsmemory
Multivariate Student t testmvt_test
A sequence of innovation-related e-mail messagesrelevents
Same culture event statisticsame_culture
Same location event statisticsame_location
Wason task performance and moralitysivan
Data come from an experimental study (Rosa, Rosa, Sarner, and Barrett, 1998) that were also used in Howell (2012, p.196). An experiment was conducted to investigate if Therapeutic Touch practitioners who were blindfolded can effectively identify which of their hands is below the experimenter¡¯s. Twenty-eight practitioners were involved and tested 10 times in the experiment. Researchers expected an average of 5 correct answers from each practitioner as it is the number by chance if they do not outperform others.therapeutic
Trends in International Mathematics and Science Study (TIMSS) 2011-2015timssICC
Precision of the Anchor Influences the Amount of Adjustmenttvprices
Facial trustworthiness and criminal sentencingwilson